PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT27471
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 234aa    MW: 25131.1 Da    PI: 9.611
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT27471genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.94.9e-34109166259
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               +Dgy+WrKYGqK vk+s+fprsYYrCt+++Cpvkk+vers +d  vv++tYeg+H+h+
  EMT27471 109 EDGYRWRKYGQKAVKNSPFPRSYYRCTTQKCPVKKRVERSFQDAAVVITTYEGKHTHP 166
               8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-3593168IPR003657WRKY domain
SuperFamilySSF1182901.31E-29100168IPR003657WRKY domain
PROSITE profilePS5081131.904103168IPR003657WRKY domain
SMARTSM007744.3E-40108167IPR003657WRKY domain
PfamPF031067.1E-27109166IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MADSSGREEP CATSHWRPGG TAHSVSVSST SSEAGVGGGA GAGEDEAGKC KQEEGEGDDE  60
SKEAAADGEA DKTKKGAAKG KGAAKVKGEK RPRQARFAFM TKSEVDHLED GYRWRKYGQK  120
AVKNSPFPRS YYRCTTQKCP VKKRVERSFQ DAAVVITTYE GKHTHPIPAT LRGANHLLAA  180
HAHAHGGHGL IHPGMFRMPA PPGAFRPGDA LGSFLQQQHA AMQHQQQQTK FCLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-2899169878Probable WRKY transcription factor 4
2lex_A4e-2899169878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418441e-104AY341844.1 Oryza sativa (japonica cultivar-group) WRKY3 mRNA, complete cds.
GenBankAY3418551e-104AY341855.1 Oryza sativa (japonica cultivar-group) WRKY14 mRNA, complete cds.
GenBankAY8706041e-104AY870604.1 Oryza sativa (japonica cultivar-group) WRKY16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008650015.12e-72PREDICTED: uncharacterized protein LOC103630738
TrEMBLM8CUJ11e-174M8CUJ1_AEGTA; Putative WRKY transcription factor 71
STRINGGRMZM2G453571_P017e-72(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.17e-47WRKY DNA-binding protein 71